PTM Viewer PTM Viewer

AT5G57530.1

Arabidopsis thaliana [ath]

xyloglucan endotransglucosylase/hydrolase 12

No PTMs currently found

PLAZA: AT5G57530
Gene Family: HOM05D000066
Other Names: AtXTH12; XTH12

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 285

MAAFATKQSPLLLASLLILIGVATGSFYDSFDITWGAGRANIFESGQLLTCTLDKTSGSGFQSKKEYLFGKIDMKIKLVPGNSAGTVTAYYLSSKGETWDEIDFEFLGNVTGQPYVIHTNVFTGGKGNREMQFYLWFDPTADFHTYTVLWNPLNIIFLVDGIPIRVFKNNEANGVAYPKSQPMKIYSSLWEADDWATQGGKVKTDWTNAPFSASYRSFNDVDCCSRTSIWNWVTCNANSNSWMWTTLNSNQLGQLKWVQKDYMIYNYCTDFKRFPQGLPTECNLN

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR000757 2 215
IPR010713 238 282
Molecule Processing
Show Type From To
Signal Peptide 1 25
Sites
Show Type Position
Metal Ion-binding Site 103
Site 101
Site 105
Active Site 105
Active Site 118
Active Site 128
Active Site 194
Active Site 199
Active Site 273

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here